PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01171.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 355aa    MW: 40971.3 Da    PI: 7.0514
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01171.1_g00008.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.65e-53171461128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPt+eel+ +yLkkkv+ ++++l +vi+evd++k+ePwdL++  ++ +  ++ewyfFs++dkky+tg+r+nrat++g+W
  Rsa1.0_01171.1_g00008.1  17 VPPGFRFHPTEEELLYYYLKKKVSYEPIDL-DVIREVDLNKLEPWDLKEkcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATAAGFW 101
                              69****************************.9***************952444443456*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              katg+dk+++ ++++++gl+ktLvfy+grap+g+kt+W+mheyrl
  Rsa1.0_01171.1_g00008.1 102 KATGRDKSIHLNSSKKIGLRKTLVFYTGRAPHGQKTEWIMHEYRL 146
                              *******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-5910166IPR003441NAC domain
PROSITE profilePS5100557.85617166IPR003441NAC domain
PfamPF023652.7E-2718146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MEIGSSSTVA GGGQLSVPPG FRFHPTEEEL LYYYLKKKVS YEPIDLDVIR EVDLNKLEPW  60
DLKEKCRIGS GPQNEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKSI HLNSSKKIGL  120
RKTLVFYTGR APHGQKTEWI MHEYRLDDNE NEIQEDGWVV CRVFKKKNHF RGFHQEQDQD  180
HHHHQYISTN NDHDHHHHQH QTESNSNNHS SLIPLSLDHH HHHIERQIQM PLHEFSNTLS  240
HGSMHLPQLF SPDSAAAAAA AQPFVLAINT TDIECSQNLL RLTSNNNNNY GGDWSFLDKL  300
LTTTNMNQQQ QMQNHQAKCF GDSSNNDQDM GNNNGNERFP FHYLGNDANL LKFPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-501416814167NO APICAL MERISTEM PROTEIN
1ut4_B2e-501416814167NO APICAL MERISTEM PROTEIN
1ut7_A2e-501416814167NO APICAL MERISTEM PROTEIN
1ut7_B2e-501416814167NO APICAL MERISTEM PROTEIN
4dul_A2e-501416814167NAC domain-containing protein 19
4dul_B2e-501416814167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893120.0AC189312.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB034L08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013726972.10.0PREDICTED: protein SOMBRERO-like
SwissprotQ9MA170.0SMB_ARATH; Protein SOMBRERO
TrEMBLA0A078DH820.0A0A078DH82_BRANA; BnaC06g39940D protein
STRINGBra035127.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66532542
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-150NAC family protein